Required for maturation of urease via the functional incorporation of the urease nickel metallocenter (By similarity). MNASDLIRIMQFGDSVLPVGAFTFSNGVESAIQTGVVRDVPTLKGFVLTALKQAASCDGMGVVAAHRAVVADDRDGIIRADWAVNNRKLNEESRLMATRMGKKLAEMSIHVVEHPLISWWLEQIKNGNTAGTYPVTQAVVMAAQGIGQREVVVMHQYGVAMTILSAAMRLMRVTHFDTQHILFELNHDIEKFCDIAEIGDIDQMSSYVPIVDVLAAVHVKAHVRLFSN Urease accessory protein ureF Expression of the urease operon increases the likelihood of bacterial survival by contibuting to acid resistance in vitro and in vivo in BALB/c mice. Y.enterocolitica enters the body via an oral path and must survive the acidic stomach before being able to colonize the intestinal mucosa (PubMed:7558281). ureF UREF_YEREN 228